PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s804101g002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family MYB
Protein Properties Length: 327aa    MW: 36121.4 Da    PI: 6.4305
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s804101g002genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.29e-142368146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                       +g+W +eEde+l ++v+++G+++W++I ++  + Rt+k+c++rw +
  PDK_30s804101g002 23 KGPWMAEEDEILMEYVRKHGPRDWSSIRSKGLLPRTGKSCRLRWVN 68
                       79*************************8876677**********87 PP

2Myb_DNA-binding45.22.2e-1480120345
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        ++++eE+ + +d+ +++G++ W++Ia +++ gRt++++k++w 
  PDK_30s804101g002  80 KFSPEEERIVIDLQARFGNK-WARIATYLP-GRTDNDVKNFWS 120
                        79******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.5621874IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-202177IPR009057Homeodomain-like
SuperFamilySSF466895.62E-2821119IPR009057Homeodomain-like
SMARTSM007172.1E-112272IPR001005SANT/Myb domain
PfamPF002492.8E-122368IPR001005SANT/Myb domain
CDDcd001673.99E-122570No hitNo description
PROSITE profilePS5129418.03775127IPR017930Myb domain
SMARTSM007171.1E-1277125IPR001005SANT/Myb domain
PfamPF002496.8E-1380120IPR001005SANT/Myb domain
CDDcd001673.33E-1180119No hitNo description
Gene3DG3DSA:1.10.10.602.1E-1780122IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MQGACGGGRR SNGKEEGGMV MRKGPWMAEE DEILMEYVRK HGPRDWSSIR SKGLLPRTGK  60
SCRLRWVNKL KPDLKTSGCK FSPEEERIVI DLQARFGNKW ARIATYLPGR TDNDVKNFWS  120
TRQKRLARIL RAPLPSKPNK NHGKVPISSH EVPVVLISSS FCHQGHSLDL ILFEGDSSNG  180
QCCQDASKIT QMPDIMSPVP LDIETALPLL EPAMEKEQCL SNTLPPPHLP FEHLPHSLLD  240
LPVLPEDPPE LLTAFGDVNF PGVHACPELC PCMAPPEGLP FFGLEAGHSG IRRVDGHPGT  300
PDIFDDLPAD MFDYLELPPA PASSTSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-28231254103MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-28231254103C-Myb DNA-Binding Domain
1msf_C2e-28231254103C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008807969.10.0PREDICTED: transcription factor MYB48-like
TrEMBLK9LXH92e-88K9LXH9_9ASPA; R2R3 MYB DUO1-like protein
STRINGSi012032m9e-85(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57003357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.11e-60MYB family protein